BAFF R Human
B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.
Product Specifications
Swiss Prot
Q96RJ3
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2μm filtered concentrated (1.0mg/mL) solution in 20mM PB, pH 8.0, 500mM NaCl.
Storage Conditions
Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1290168-01 0.02 mg (E-Coli)
Recombinant Mouse Lens epithelial cell protein LEP503 (Lenep)
Sign In for Pricing
View Details MBS1290168-02 0.1 mg (E-Coli)
Recombinant Mouse Lens epithelial cell protein LEP503 (Lenep)
Sign In for Pricing
View Details MBS1290168-03 0.02 mg (Yeast)
Recombinant Mouse Lens epithelial cell protein LEP503 (Lenep)
Sign In for Pricing
View Details MBS1290168-04 0.1 mg (Yeast)
Recombinant Mouse Lens epithelial cell protein LEP503 (Lenep)
Sign In for Pricing
View Details MBS1290168-05 0.02 mg (Baculovirus)
Recombinant Mouse Lens epithelial cell protein LEP503 (Lenep)
Sign In for Pricing
View Details