AIF1 Human
The AIF1 Human Recombinant contains a total of 155 amino acids having a molecular Mass of 17.7kDa. The Human AIF1 is fused to a 9 amino acid long N-terminal His tag.
Product Specifications
Swiss Prot
P55008
Source
E. Coli.
Buffer
Filtered and lyophilized from 0.5mg/mL in 20mM Tris buffer and 50mM NaCl pH-7.5.
Storage Conditions
For long term, store lyophilized AIF1 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Product Datasheet
https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=99102
Sequence Similarities
SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP.
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items