Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP 7 Human, Plant

Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.

Product Specifications

Swiss Prot

P18075

Source

Nicotiana benthamiana.

Buffer

BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.

Storage Conditions

Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexokinase II (HK2) (1-917) Mouse Monoclonal Antibody [Clone ID: 1A7]
AM03129PU-N 100 µL

Hexokinase II (HK2) (1-917) Mouse Monoclonal Antibody [Clone ID: 1A7]

Sign In for Pricing
View Details
Human PUF60 activation kit by CRISPRa
GA107835 1 Kit

Human PUF60 activation kit by CRISPRa

Sign In for Pricing
View Details
Pdcd1 (NM_008798) Mouse Recombinant Protein
TP700258 20 µg

Pdcd1 (NM_008798) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant Hsp70 Monoclonal Antibody
AN301055L-01 50 µL

Recombinant Hsp70 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Hsp70 Monoclonal Antibody
AN301055L-02 100 µL

Recombinant Hsp70 Monoclonal Antibody

Sign In for Pricing
View Details
SPATS2L (NM_001100422) Human Over-expression Lysate
LY420261 100 µg

SPATS2L (NM_001100422) Human Over-expression Lysate

Sign In for Pricing
View Details