Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP 7 Human, Plant

Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.

Product Specifications

Swiss Prot

P18075

Source

Nicotiana benthamiana.

Buffer

BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.

Storage Conditions

Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Fallopian tube
CS635513 5x 5 µm

Frozen Tissue Sections, Fallopian tube

Sign In for Pricing
View Details
Ubiquitin Monoclonal Antibody
E-AB-22131-01 20 µL

Ubiquitin Monoclonal Antibody

Sign In for Pricing
View Details
Ubiquitin Monoclonal Antibody
E-AB-22131-02 60 µL

Ubiquitin Monoclonal Antibody

Sign In for Pricing
View Details
Ubiquitin Monoclonal Antibody
E-AB-22131-03 120 µL

Ubiquitin Monoclonal Antibody

Sign In for Pricing
View Details
Ubiquitin Monoclonal Antibody
E-AB-22131-04 200 µL

Ubiquitin Monoclonal Antibody

Sign In for Pricing
View Details
5-Chloro-2-thiazol-4-yl-1H-benzoimidazole
TRC-C408580-50MG 50 mg

5-Chloro-2-thiazol-4-yl-1H-benzoimidazole

Sign In for Pricing
View Details