BMP 7 Human, Plant
Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.
Product Specifications
Swiss Prot
P18075
Source
Nicotiana benthamiana.
Buffer
BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Storage Conditions
Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942474-500 1x 500 µL
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042313-100 1x 100 µL
Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470264-500 1x 500 µL
Human Kappa Light Chain (KLC264), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
