Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acrp30 Human

The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244) .

Product Specifications

Swiss Prot

Q15848

Source

Escherichia Coli.

Buffer

Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.

Sequence Similarities

MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PLAG1 Monoclonal Antibody
AN301944L-01 50 µL

Recombinant PLAG1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PLAG1 Monoclonal Antibody
AN301944L-02 100 µL

Recombinant PLAG1 Monoclonal Antibody

Sign In for Pricing
View Details
ZNF90 Human qPCR Primer Pair (NM_007138)
HP226735 200 Reactions

ZNF90 Human qPCR Primer Pair (NM_007138)

Sign In for Pricing
View Details
HP1 gamma (CBX3) Human Gene Knockout Kit (CRISPR)
KN401478 1 Kit

HP1 gamma (CBX3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat Platelet/Endothelial Cell Adhesion Molecule (PECAM1) ELISA Kit
RDR-PECAM1-Ra-01 96 Tests

Rat Platelet/Endothelial Cell Adhesion Molecule (PECAM1) ELISA Kit

Sign In for Pricing
View Details
Rat Platelet/Endothelial Cell Adhesion Molecule (PECAM1) ELISA Kit
RDR-PECAM1-Ra-02 48 Tests

Rat Platelet/Endothelial Cell Adhesion Molecule (PECAM1) ELISA Kit

Sign In for Pricing
View Details