Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acrp30 Human

The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244) .

Product Specifications

Swiss Prot

Q15848

Source

Escherichia Coli.

Buffer

Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.

Sequence Similarities

MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmin (Muscle Cell Marker) (DES/1711), CF594 conjugate, 0.1mg/mL
BNC941711-500 1x 500 µL

Desmin (Muscle Cell Marker) (DES/1711), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Maytansinol
TRC-M197950-50MG 50 mg

Maytansinol

Sign In for Pricing
View Details
N-Acetyl-4-benzoquinone Imine-D3
TRC-A170002-1MG 1 mg

N-Acetyl-4-benzoquinone Imine-D3

Sign In for Pricing
View Details
Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF568 conjugate, 0.1mg/mL
BNC682983-100 1x 100 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trichloroethylene-d
TRC-T774031-50MG 50 mg

Trichloroethylene-d

Sign In for Pricing
View Details
N-Formyl-L-leucine [S-(E)]-1-(2-Nonenyl)dodecyl Ester
TRC-F700575-5MG 5 mg

N-Formyl-L-leucine [S-(E)]-1-(2-Nonenyl)dodecyl Ester

Sign In for Pricing
View Details