Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acrp30 Human

The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244) .

Product Specifications

Swiss Prot

Q15848

Source

Escherichia Coli.

Buffer

Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.

Sequence Similarities

MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Muc1 activation kit by CRISPRa
GA202759 1 Kit

Mouse Muc1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS713361 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
CD64 (10.1), 0.2mg/mL
BNUB2846-100 1x 100 µL

CD64 (10.1), 0.2mg/mL

Sign In for Pricing
View Details
CISD1 Mouse Monoclonal Antibody [Clone ID: AT1A8]
AM50028PU-S 50 µL

CISD1 Mouse Monoclonal Antibody [Clone ID: AT1A8]

Sign In for Pricing
View Details
Human LRRC74B activation kit by CRISPRa
GA118293 1 Kit

Human LRRC74B activation kit by CRISPRa

Sign In for Pricing
View Details
Indiplon
TRC-I527200-2.5MG 2.5 mg

Indiplon

Sign In for Pricing
View Details