Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 1 alpha Human

Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton.

Product Specifications

Swiss Prot

P01583

Source

Escherichia Coli.

Buffer

The protein was lyophilized from a concentrated (1 mg/mL) sterile solution containing 25mM Tris-HCl, pH 8.

Storage Conditions

Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-654-3p miRNA Antagomir
CIJ0639-01 10 nmol

Hsa-miR-654-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-654-3p miRNA Antagomir
CIJ0639-02 20 nmol

Hsa-miR-654-3p miRNA Antagomir

Sign In for Pricing
View Details
SARS-CoV-2 ORF8 Gene cDNA Clone (Native Sequence)
VC202562 10 µg

SARS-CoV-2 ORF8 Gene cDNA Clone (Native Sequence)

Sign In for Pricing
View Details
RMND5B Polyclonal Antibody
E-AB-18705-01 20 µL

RMND5B Polyclonal Antibody

Sign In for Pricing
View Details
RMND5B Polyclonal Antibody
E-AB-18705-02 60 μL

RMND5B Polyclonal Antibody

Sign In for Pricing
View Details
RMND5B Polyclonal Antibody
E-AB-18705-03 120 μL

RMND5B Polyclonal Antibody

Sign In for Pricing
View Details