Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 1 alpha Human

Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton.

Product Specifications

Swiss Prot

P01583

Source

Escherichia Coli.

Buffer

The protein was lyophilized from a concentrated (1 mg/mL) sterile solution containing 25mM Tris-HCl, pH 8.

Storage Conditions

Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VDAC Rabbit Polyclonal Antibody (BF350)
orb2512787 100 µL

VDAC Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Human NKG2D ligand 4, RAET1E ELISA Kit
MBS1606666-01 48 Well

Human NKG2D ligand 4, RAET1E ELISA Kit

Sign In for Pricing
View Details
Human NKG2D ligand 4, RAET1E ELISA Kit
MBS1606666-02 96 Well

Human NKG2D ligand 4, RAET1E ELISA Kit

Sign In for Pricing
View Details
Human NKG2D ligand 4, RAET1E ELISA Kit
MBS1606666-03 5x 96 Well

Human NKG2D ligand 4, RAET1E ELISA Kit

Sign In for Pricing
View Details
Human NKG2D ligand 4, RAET1E ELISA Kit
MBS1606666-04 10x 96 Well

Human NKG2D ligand 4, RAET1E ELISA Kit

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida accA Protein (aa 1-317)
VAng-Cr6689-1mgEcoli 1 mg (E. coli)

Recombinant Pasteurella Multocida accA Protein (aa 1-317)

Sign In for Pricing
View Details