IL 1 alpha Human
Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton.
Product Specifications
Swiss Prot
P01583
Source
Escherichia Coli.
Buffer
The protein was lyophilized from a concentrated (1 mg/mL) sterile solution containing 25mM Tris-HCl, pH 8.
Storage Conditions
Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A03227-3-Fluoro488 100 µg/Vial
Anti-DR3/Tnfrsf25 Antibody Picoband® Fluoro488 Conjugated
Sign In for Pricing
View Details 
MBS6500829-01 0.1 mL
STC1, ID (Stanniocalcin-1, STC-1, STC) (MaxLight 405)
Sign In for Pricing
View Details MBS6500829-02 5x 0.1 mL
STC1, ID (Stanniocalcin-1, STC-1, STC) (MaxLight 405)
Sign In for Pricing
View Details 
K2355608 1.0 µg DNA
TEAD3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details