Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 1 alpha Human

Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton.

Product Specifications

Swiss Prot

P01583

Source

Escherichia Coli.

Buffer

The protein was lyophilized from a concentrated (1 mg/mL) sterile solution containing 25mM Tris-HCl, pH 8.

Storage Conditions

Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD9 Reference Antibody (Genentech anti-CD9)
E24CHA725 100 µg

Anti-CD9 Reference Antibody (Genentech anti-CD9)

Sign In for Pricing
View Details
RPS27 sgRNA CRISPR Lentivector set (Human)
K2054101 3x 1.0 µg

RPS27 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human VSIG8 (C-6His)
PHH1820-01 10 µg

Recombinant Human VSIG8 (C-6His)

Sign In for Pricing
View Details
Recombinant Human VSIG8 (C-6His)
PHH1820-02 50 µg

Recombinant Human VSIG8 (C-6His)

Sign In for Pricing
View Details
Recombinant Human VSIG8 (C-6His)
PHH1820-03 500 µg

Recombinant Human VSIG8 (C-6His)

Sign In for Pricing
View Details
Mouse Sex Determining Region Y Box Protein 2 (SOX2) ELISA kit
QY-E21354 96 Tests

Mouse Sex Determining Region Y Box Protein 2 (SOX2) ELISA kit

Sign In for Pricing
View Details