Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 1 beta Human, HEK

Interleukin-1 beta Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation.

Product Specifications

Swiss Prot

P01584

Source

HEK.

Buffer

The IL-1 beta was lyophilized from 1 mg/mL in 1xPBS.

Storage Conditions

Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-(Trifluoroacetyl)thiophene-2-carboxylic Acid
TRC-T789750-1G 1 g

5-(Trifluoroacetyl)thiophene-2-carboxylic Acid

Sign In for Pricing
View Details
RASSF2 Human Gene Knockout Kit (CRISPR)
KN416299 1 Kit

RASSF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KLF15 (NM_014079) Human Recombinant Protein
TP307523L 1 mg

KLF15 (NM_014079) Human Recombinant Protein

Sign In for Pricing
View Details
DMC1 (2H12/4), CF647 conjugate, 0.1mg/mL
BNC472178-500 1x 500 µL

DMC1 (2H12/4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rrp1 Mouse Gene Knockout Kit (CRISPR)
KN515143 1 Kit

Rrp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLN Human Gene Knockout Kit (CRISPR)
KN402706 1 Kit

SLN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details