IL 1 beta Human, HEK
Interleukin-1 beta Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation.
Product Specifications
Swiss Prot
P01584
Source
HEK.
Buffer
The IL-1 beta was lyophilized from 1 mg/mL in 1xPBS.
Storage Conditions
Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880862-100 1x 100 µL
Glypican-3 (1G12), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
