Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 1 beta Human, HEK

Interleukin-1 beta Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation.

Product Specifications

Swiss Prot

P01584

Source

HEK.

Buffer

The IL-1 beta was lyophilized from 1 mg/mL in 1xPBS.

Storage Conditions

Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL6 siRNA (Rat)
CRR4097-01 15 nmol

METTL6 siRNA (Rat)

Sign In for Pricing
View Details
METTL6 siRNA (Rat)
CRR4097-02 30 nmol

METTL6 siRNA (Rat)

Sign In for Pricing
View Details
Mephenesin (Standard)
HY-B1283R-01 10 mg

Mephenesin (Standard)

Sign In for Pricing
View Details
Mephenesin (Standard)
HY-B1283R-02 50 mg

Mephenesin (Standard)

Sign In for Pricing
View Details
Mephenesin (Standard)
HY-B1283R-03 100 mg

Mephenesin (Standard)

Sign In for Pricing
View Details
Mephenesin (Standard)
HY-B1283R-04 250 mg

Mephenesin (Standard)

Sign In for Pricing
View Details