IL 1 beta Human, HEK
Interleukin-1 beta Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation.
Product Specifications
Swiss Prot
P01584
Source
HEK.
Buffer
The IL-1 beta was lyophilized from 1 mg/mL in 1xPBS.
Storage Conditions
Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042378-100 1x 100 µL
P21WAF1 (Tumor Suppressor Protein) (AC8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![PE/Cyanine7 Anti-Mouse CD103 Antibody[M290]](https://cdn.genprice.uk/products/763/68dd14ad061270361e7d3441/imageurl/e-ab-f1090h.webp)
E-AB-F1090H-01 50 Tests
PE/Cyanine7 Anti-Mouse CD103 Antibody[M290]
Sign In for Pricing
View Details E-AB-F1090H-02 100 Tests
PE/Cyanine7 Anti-Mouse CD103 Antibody[M290]
Sign In for Pricing
View Details E-AB-F1090H-03 2x 100 Tests
PE/Cyanine7 Anti-Mouse CD103 Antibody[M290]
Sign In for Pricing
View Details 
BNC882197-100 1x 100 µL
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details