IL 1 beta Rat
Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.
Product Specifications
Swiss Prot
Q63264
Source
Escherichia Coli.
Buffer
The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.
Storage Conditions
Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880742-100 1x 100 µL
Prolactin Receptor (PRLR/742), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041610-500 1x 500 µL
CD51 / Integrin V (ITGAV/1610), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 