Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 13 Human

Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa.

Product Specifications

Swiss Prot

P35225

Source

Escherichia Coli.

Buffer

The protein (1 mg/mL) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.

Storage Conditions

Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LAG-3, Tag Free
HA210934-01 Inquire

Human LAG-3, Tag Free

Sign In for Pricing
View Details
Human LAG-3, Tag Free
HA210934-02 50 µg

Human LAG-3, Tag Free

Sign In for Pricing
View Details
Human LAG-3, Tag Free
HA210934-03 100 µg

Human LAG-3, Tag Free

Sign In for Pricing
View Details
N-4-Hydroxyphenyl-N'-1,2,3-thiadiazol-5-ylurea
TRC-H949385-250MG 250 mg

N-4-Hydroxyphenyl-N'-1,2,3-thiadiazol-5-ylurea

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743J-01 25 µg

PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743J-02 100 µg

PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details