IL 13 Human
Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa.
Product Specifications
Swiss Prot
P35225
Source
Escherichia Coli.
Buffer
The protein (1 mg/mL) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.
Storage Conditions
Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH031307 100 µg
Recombinant Human CCNA1/Cyclin-A1 Protein (His Tag)
Sign In for Pricing
View Details 
![2-(10,11-Dihydro-5H-dibenzo[a,d]cyclohepten-5-ylidene)acetaldehyde](https://cdn.genprice.uk/products/572/6231693938564/imageurl/trc-d662170-5mg.webp)
TRC-D662170-5MG 5 mg
2-(10,11-Dihydro-5H-dibenzo[a,d]cyclohepten-5-ylidene)acetaldehyde
Sign In for Pricing
View Details 