IL 13 Human
Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa.
Product Specifications
Swiss Prot
P35225
Source
Escherichia Coli.
Buffer
The protein (1 mg/mL) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.
Storage Conditions
Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rat IgM Mu chain specific F(ab’)2 Fragment Mouse Monoclonal Antibody [Clone ID: M 2A1]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fc148/imageurl/am08096pu-n.webp)
AM08096PU-N 500 µg
Rat IgM Mu chain specific F(ab’)2 Fragment Mouse Monoclonal Antibody [Clone ID: M 2A1]
Sign In for Pricing
View Details 
