Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 17 A/F Mouse

Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.

Product Specifications

Source

Escherichia Coli.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sbspon Mouse Gene Knockout Kit (CRISPR)
KN515325 1 Kit

Sbspon Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NFATC4 (NM_001136022) Human Over-expression Lysate
LY427771 100 µg

NFATC4 (NM_001136022) Human Over-expression Lysate

Sign In for Pricing
View Details
Phosphoserine (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 4A3]
AM00113PU-N 100 µg

Phosphoserine (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 4A3]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details