Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 17 A/F Mouse

Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.

Product Specifications

Source

Escherichia Coli.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WNT10A activation kit by CRISPRa
GA112926 1 Kit

Human WNT10A activation kit by CRISPRa

Sign In for Pricing
View Details
Talniflumate
TRC-T005575-25MG 25 mg

Talniflumate

Sign In for Pricing
View Details
CREM Mouse Monoclonal Antibody [Clone ID: OTI6H4]
CF812013 100 µg

CREM Mouse Monoclonal Antibody [Clone ID: OTI6H4]

Sign In for Pricing
View Details
CA5B Antibody
KC-7313-01 50 μL

CA5B Antibody

Sign In for Pricing
View Details
CA5B Antibody
KC-7313-02 100 µL

CA5B Antibody

Sign In for Pricing
View Details
CA5B Antibody
KC-7313-03 1 mL

CA5B Antibody

Sign In for Pricing
View Details