IL 17 A/F Mouse
Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.
Product Specifications
Source
Escherichia Coli.
Buffer
Lyophilized from a concentrated (1 mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN402571 1 Kit
Uroplakin IIIB (UPK3B) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details ![Human CD45 Recombinant Mouse Monoclonal Antibody [PSH03-64]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81d9e/imageurl/ha601285.webp)
HA601285 100 µL
Human CD45 Recombinant Mouse Monoclonal Antibody [PSH03-64]
Sign In for Pricing
View Details 
BNCB1999-500 1x 500 µL
Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 