Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 17 A/F Mouse

Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.

Product Specifications

Source

Escherichia Coli.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hmgb2 (BC002050) Mouse Tagged ORF Clone Lentiviral Particle
MR202276L4V 200 µL

Hmgb2 (BC002050) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
GPSM2 Polyclonal Antibody
BT-AP09699-01 20 µL

GPSM2 Polyclonal Antibody

Ask
View Details
GPSM2 Polyclonal Antibody
BT-AP09699-02 50 µL

GPSM2 Polyclonal Antibody

Ask
View Details
GPSM2 Polyclonal Antibody
BT-AP09699-03 100 µL

GPSM2 Polyclonal Antibody

Ask
View Details
Recombinant SARS-CoV-2 RBD (Mu) Protein, C-His
VK565161-01 50 µg

Recombinant SARS-CoV-2 RBD (Mu) Protein, C-His

Ask
View Details
Recombinant SARS-CoV-2 RBD (Mu) Protein, C-His
VK565161-02 100 µg

Recombinant SARS-CoV-2 RBD (Mu) Protein, C-His

Ask
View Details