Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 17 A/F Mouse

Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.

Product Specifications

Source

Escherichia Coli.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc52a3 Mouse Gene Knockout Kit (CRISPR)
KN516153 1 Kit

Slc52a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2881), CF740 conjugate, 0.1mg/mL
BNC742881-500 1x 500 µL

CD63 (Late Endosomes Marker) (LAMP3/2881), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRMT1 (TRMU) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A4]
TA505699BM 100 µL

TRMT1 (TRMU) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A4]

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB24), Biotin conjugate, 0.1mg/mL
BNCB0024-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB24), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GSG1 (NM_031289) Human Over-expression Lysate
LY403106 100 µg

GSG1 (NM_031289) Human Over-expression Lysate

Sign In for Pricing
View Details
Microwave Digester BMWD-101
BMWD-101 1 Unit

Microwave Digester BMWD-101

Sign In for Pricing
View Details