Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 17 A/F Mouse

Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.

Product Specifications

Source

Escherichia Coli.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM166B (NM_001099951) Human Over-expression Lysate
LY420215 100 µg

FAM166B (NM_001099951) Human Over-expression Lysate

Sign In for Pricing
View Details
Frequenin (NCS1) Rabbit Polyclonal Antibody
AP07405PU-N 50 µg

Frequenin (NCS1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat IgG (H&L) Antibody Alkaline Phosphatase Conjugated
TA398033 1 mg

Rat IgG (H&L) Antibody Alkaline Phosphatase Conjugated

Sign In for Pricing
View Details
Serine racemase (SRR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7G6]
TA500958AM 100 µL

Serine racemase (SRR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7G6]

Sign In for Pricing
View Details
CIAP2 Antibody
KC-28601-01 50 μL

CIAP2 Antibody

Sign In for Pricing
View Details
CIAP2 Antibody
KC-28601-02 100 µL

CIAP2 Antibody

Sign In for Pricing
View Details