IL 17 A/F Mouse
Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.
Product Specifications
Source
Escherichia Coli.
Buffer
Lyophilized from a concentrated (1 mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
IPD4400-B400F2 1 Each
Blender bag, 400ml x 70µm with full nylon filter, 300 x 190mm, pack of 500 (10 pack of 50)
Sign In for Pricing
View Details 
