IL 17 A/F Mouse
Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.
Product Specifications
Source
Escherichia Coli.
Buffer
Lyophilized from a concentrated (1 mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.
Product Datasheet
https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=258136
Sequence Similarities
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Mouse Monoclonal BACE-2 Antibody (1/ 9) [DyLight 755]](https://cdn.genprice.uk/genprice/genprice5.png)
