IL 17 A/F Mouse
Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.
Product Specifications
Source
Escherichia Coli.
Buffer
Lyophilized from a concentrated (1 mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042987-100 1x 100 µL
Microphthalmia Transcription Factor (MITF) (MITF/2987R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-C379795-5ML 5 mL
3-Chloroprionaldehyde Diethyl Acetal, Technical grade (Stabilized)
Sign In for Pricing
View Details 
BNC743338-100 1x 100 µL
CD11b / MAC-1 (Microglial Marker) (ITGAM/3338), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 