Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 17 A/F Mouse

Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.

Product Specifications

Source

Escherichia Coli.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

C1qtnf7 (NM_175425) Mouse Untagged Clone
MC212203 10 µg

C1qtnf7 (NM_175425) Mouse Untagged Clone

Ask
View Details
Mitotic checkpoint protein BUB3 (BUB3)
144904 100 µg

Mitotic checkpoint protein BUB3 (BUB3)

Ask
View Details
Rat Vitamin D Receptor (VDR) ELISA Kit
EKN49280 96 Tests

Rat Vitamin D Receptor (VDR) ELISA Kit

Ask
View Details
C17orf87 (SCIMP) (NM_207103) Human Recombinant Protein
TP313295L 1 mg

C17orf87 (SCIMP) (NM_207103) Human Recombinant Protein

Ask
View Details
Human GDP-Mannose 4,6 Dehydratase (GMDS) ELISA Kit
abx387589 96 Tests

Human GDP-Mannose 4,6 Dehydratase (GMDS) ELISA Kit

Ask
View Details