Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 17 A/F Mouse

Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.

Product Specifications

Source

Escherichia Coli.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNBP3 (PRPF40A) Rabbit Polyclonal Antibody
TA370773 100 µL

FNBP3 (PRPF40A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Free Lambda Light Chain,  15nm
GM-102-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Free Lambda Light Chain, 15nm

Sign In for Pricing
View Details
FITC Conjugated Vicia graminea Lectin -VGA-
F-4400-2 2 mL

FITC Conjugated Vicia graminea Lectin -VGA-

Sign In for Pricing
View Details
Anti-FGL1
Y158545 100 µL

Anti-FGL1

Sign In for Pricing
View Details
Exonuclease 1 (EXO1) Human Gene Knockout Kit (CRISPR)
KN400547 1 Kit

Exonuclease 1 (EXO1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TTC32 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C12]
TA501341AM 100 µL

TTC32 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C12]

Sign In for Pricing
View Details