IL 17 A/F Mouse
Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.
Product Specifications
Source
Escherichia Coli.
Buffer
Lyophilized from a concentrated (1 mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS6162631-01 0.1 mL
EFHD1 (EF-hand Domain Family, Member D1, DKFZp781H0842, FLJ13612, MST133, MSTP133, PP3051) (AP)
Ask
View Details MBS6162631-02 5x 0.1 mL
EFHD1 (EF-hand Domain Family, Member D1, DKFZp781H0842, FLJ13612, MST133, MSTP133, PP3051) (AP)
Ask
View Details MBS2142317-01 0.1 mL
FITC-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
Ask
View Details