Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 17 A/F Mouse

Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.

Product Specifications

Source

Escherichia Coli.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF594 conjugate, 0.1mg/mL
BNC941373-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thiamphenicol
TRC-T344160-1G 1 g

Thiamphenicol

Sign In for Pricing
View Details
ROS1 Recombinant Rabbit Monoclonal Antibody [PD01-27]
HA721420 100 µL

ROS1 Recombinant Rabbit Monoclonal Antibody [PD01-27]

Sign In for Pricing
View Details
Moesin (MSN) Mouse Monoclonal Antibody [Clone ID: MSN491]
AM50299PU-S 100 µg

Moesin (MSN) Mouse Monoclonal Antibody [Clone ID: MSN491]

Sign In for Pricing
View Details
FCGR3B Antibody
KC-634-01 50 μL

FCGR3B Antibody

Sign In for Pricing
View Details
FCGR3B Antibody
KC-634-02 100 µL

FCGR3B Antibody

Sign In for Pricing
View Details