IL 19 Mouse
Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa.
Product Specifications
Swiss Prot
Q8CJ70
Source
Escherichia Coli.
Buffer
Lyophilized from a sterile filtered aqueous solution containing 5mM Na
Storage Conditions
Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6321824-01 0.2 mL
MOV10, NT (MOV10, KIAA1631, Putative helicase MOV-10, Moloney leukemia virus 10 protein) (APC)
Sign In for Pricing
View Details MBS6321824-02 5x 0.2 mL
MOV10, NT (MOV10, KIAA1631, Putative helicase MOV-10, Moloney leukemia virus 10 protein) (APC)
Sign In for Pricing
View Details IL-0318-HP-0050 50 g
1-Butyl-1-methylpyrrolidinium tricyanomethanide
Sign In for Pricing
View Details