Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17F Mouse

IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa.

Product Specifications

Swiss Prot

Q7TNI7

Source

Escherichia Coli.

Buffer

IL17F was lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NSDHL Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62923R-BF350-01 20 µL

NSDHL Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Ask
View Details
NSDHL Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62923R-BF350-02 100 µL

NSDHL Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Ask
View Details
PDGF Receptor beta (PDGFRB) Mouse Monoclonal Antibody [Clone ID: OTI1E8]
TA506230S 30 µL

PDGF Receptor beta (PDGFRB) Mouse Monoclonal Antibody [Clone ID: OTI1E8]

Ask
View Details
Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)
MBS7034592-01 0.02 mg

Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)

Ask
View Details
Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)
MBS7034592-02 0.1 mg

Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)

Ask
View Details
Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)
MBS7034592-03 5x 0.1 mg

Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)

Ask
View Details