Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17E Mouse

Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.

Product Specifications

Swiss Prot

Q8VHH8

Source

Escherichia Coli.

Buffer

IL17E was lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus cereus Acetate kinase (ackA)
MBS1434128-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus Acetate kinase (ackA)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Acetate kinase (ackA)
MBS1434128-02 0.02 mg (Yeast)

Recombinant Bacillus cereus Acetate kinase (ackA)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Acetate kinase (ackA)
MBS1434128-03 0.1 mg (E-Coli)

Recombinant Bacillus cereus Acetate kinase (ackA)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Acetate kinase (ackA)
MBS1434128-04 0.1 mg (Yeast)

Recombinant Bacillus cereus Acetate kinase (ackA)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Acetate kinase (ackA)
MBS1434128-05 0.02 mg (Baculovirus)

Recombinant Bacillus cereus Acetate kinase (ackA)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Acetate kinase (ackA)
MBS1434128-06 0.02 mg (Mammalian-Cell)

Recombinant Bacillus cereus Acetate kinase (ackA)

Sign In for Pricing
View Details