IL17E Mouse
Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.
Product Specifications
Swiss Prot
Q8VHH8
Source
Escherichia Coli.
Buffer
IL17E was lyophilized from a concentrated (1 mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
XWC29781-01 50 mg
1- (Propan-2-yl) piperidin-3-amine dihydrochloride
Sign In for Pricing
View Details XWC29781-02 0.5 g
1- (Propan-2-yl) piperidin-3-amine dihydrochloride
Sign In for Pricing
View Details 