Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17E Mouse

Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.

Product Specifications

Swiss Prot

Q8VHH8

Source

Escherichia Coli.

Buffer

IL17E was lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Alg1 Pre-designed siRNA Set B
SI200512B 1 Each

Rat Alg1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
A930001N09Rik 3'UTR Luciferase Stable Cell Line
TU101093 1.0 mL

A930001N09Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Paulomenol B
HY-N14656 1 Each

Paulomenol B

Sign In for Pricing
View Details
POLR3C Antibody
MBS7117878-01 0.05 mg

POLR3C Antibody

Sign In for Pricing
View Details
POLR3C Antibody
MBS7117878-02 0.1 mg

POLR3C Antibody

Sign In for Pricing
View Details
POLR3C Antibody
MBS7117878-03 5x 0.1 mg

POLR3C Antibody

Sign In for Pricing
View Details