IL37 Human
Interleukin-37 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa.
Product Specifications
Swiss Prot
Q9NZH6
Source
Escherichia Coli.
Buffer
IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4.
Storage Conditions
Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-13322R-PerCP-Cy5.5 100 µL
GCS1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
Sign In for Pricing
View Details 
247511-ML490 100 µL
IL13 (Interleukin 13, ALRH, BHR1, IL-13, MGC116786, MGC116788, MGC116789, P600) (MaxLight 490)
Sign In for Pricing
View Details