Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL37 Human

Interleukin-37 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa.

Product Specifications

Swiss Prot

Q9NZH6

Source

Escherichia Coli.

Buffer

IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4.

Storage Conditions

Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aeromonas Hydrophila rplN Protein
VAng-Lsx0743-50gEcoli 50 µg (E. coli)

Recombinant Aeromonas Hydrophila rplN Protein

Sign In for Pricing
View Details
DSPE-PEG-DBCO (MW 600)
HY-W440835B 1 Each

DSPE-PEG-DBCO (MW 600)

Sign In for Pricing
View Details
Arhgap4 Mouse shRNA Plasmid (Locus ID 171207)
TL516415 1 Kit

Arhgap4 Mouse shRNA Plasmid (Locus ID 171207)

Sign In for Pricing
View Details
Sheep A disintegrin and metalloproteinase with thrombospondin motifs 8 (ADAMTS8) ELISA Kit
MBS7236280-01 48 Well

Sheep A disintegrin and metalloproteinase with thrombospondin motifs 8 (ADAMTS8) ELISA Kit

Sign In for Pricing
View Details
Sheep A disintegrin and metalloproteinase with thrombospondin motifs 8 (ADAMTS8) ELISA Kit
MBS7236280-02 96 Well

Sheep A disintegrin and metalloproteinase with thrombospondin motifs 8 (ADAMTS8) ELISA Kit

Sign In for Pricing
View Details
Sheep A disintegrin and metalloproteinase with thrombospondin motifs 8 (ADAMTS8) ELISA Kit
MBS7236280-03 5x 96 Well

Sheep A disintegrin and metalloproteinase with thrombospondin motifs 8 (ADAMTS8) ELISA Kit

Sign In for Pricing
View Details