IL37 Human
Interleukin-37 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa.
Product Specifications
Swiss Prot
Q9NZH6
Source
Escherichia Coli.
Buffer
IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4.
Storage Conditions
Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEK
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
589175 96 Tests
Cyclin Dependent Kinase Inhibitor 1A (CDKN1A) BioAssayTM ELISA Kit (Human)
Ask
View Details 
