Kras4B, Human (184a.a, G12V, His)
KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. Kras4B Protein, Human (184a.a, G12V, His) is the recombinant human-derived KRAS protein, expressed by E. coli , with N-6*His labeled tag and G12V mutation.
Product Specifications
Product Name Alternative
Kras4B Protein, Human (184a.a, G12V, His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/kras-protein-human-g12v-his.html
Purity
98.0
Smiles
HHHHHHTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Molecular Formula
3845 (Gene_ID) AAH13572.1 (T2-C185, G12V) (Accession)
Molecular Weight
25-30 kDa, observed by reducing SDS-PAGE
References & Citations
[1]Jianhua Ling, et al. KrasG12D-induced IKK2/β/NF-κB activation by IL-1α and p62 feedforward loops is required for development of pancreatic ductal adenocarcinoma. Cancer Cell. 2012 Jan 17;21 (1) :105-20.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-2928R-BF680-TR 20 µL
PDLIM3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
Sign In for Pricing
View Details 