TWSG1, Human (HEK293, His)
The TWSG1 protein plays a dual role in BMP signaling, acting as both an antagonist and an agonist. It forms a ternary complex with CHRD and BMP, blocking BMP receptor binding, thereby antagonizing BMP signaling. TWSG1 Protein, Human (HEK293, His) is the recombinant human-derived TWSG1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
TWSG1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/twsg1-protein-human-hek-293-his.html
Purity
95.0
Smiles
CNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Molecular Formula
57045 (Gene_ID) Q9GZX9-1 (C26-F223) (Accession)
Molecular Weight
Approximately 35.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6244267-01 0.1 mL
CD44S (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (PE)
Sign In for Pricing
View Details MBS6244267-02 5x 0.1 mL
CD44S (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (PE)
Sign In for Pricing
View Details 
A00031-4-Dylight550 100 µg
Anti-CXCR4 Antibody Picoband®, Dylight550 Conjugate
Sign In for Pricing
View Details