Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM25, Human (HEK293, His)

TMEM25 Protein, crucial in neurons, modulates the degradation of the NMDA receptor GRIN2B subunit, influencing the intricate regulation of neuronal excitability. Its interaction with GRIN2B highlights its role in dynamic processes central to neurotransmission and synaptic function. TMEM25 Protein, Human (HEK293, His) is the recombinant human-derived TMEM25 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM25 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem25-protein-human-hek293-his.html

Purity

98.0

Smiles

ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAP

Molecular Formula

84866 (Gene_ID) Q86YD3-2/AAH51841.1 (E27-P224) (Accession)

Molecular Weight

Approximately 32-60 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC13B Antibody, Biotin conjugated
A38071-50UL 50 μL

UNC13B Antibody, Biotin conjugated

Sign In for Pricing
View Details
TCF4 Rabbit pAb
E45R18446N-100 100 µL

TCF4 Rabbit pAb

Sign In for Pricing
View Details
RENBP (NM_002910) Human Untagged Clone
SC319345 10 µg

RENBP (NM_002910) Human Untagged Clone

Sign In for Pricing
View Details
Cytochrome C Oxidase Subunit 4I1 (COX4I1) Antibody
abx159455-01 50 µg

Cytochrome C Oxidase Subunit 4I1 (COX4I1) Antibody

Sign In for Pricing
View Details
Cytochrome C Oxidase Subunit 4I1 (COX4I1) Antibody
abx159455-02 100 µg

Cytochrome C Oxidase Subunit 4I1 (COX4I1) Antibody

Sign In for Pricing
View Details
Carbonic anhydrase 12 (25-301, His-tag) Human Protein
AR51944PU-S 50 µg

Carbonic anhydrase 12 (25-301, His-tag) Human Protein

Sign In for Pricing
View Details