Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM25, Human (HEK293, His)

TMEM25 Protein, crucial in neurons, modulates the degradation of the NMDA receptor GRIN2B subunit, influencing the intricate regulation of neuronal excitability. Its interaction with GRIN2B highlights its role in dynamic processes central to neurotransmission and synaptic function. TMEM25 Protein, Human (HEK293, His) is the recombinant human-derived TMEM25 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM25 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem25-protein-human-hek293-his.html

Purity

98.0

Smiles

ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAP

Molecular Formula

84866 (Gene_ID) Q86YD3-2/AAH51841.1 (E27-P224) (Accession)

Molecular Weight

Approximately 32-60 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORM1 Recombinant Protein (Mouse)
RP159446 100 µg

ORM1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
dcTRAILR2 Double Nickase Plasmid (m)
sc-429765-NIC 20 µg

dcTRAILR2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Rabbit Polyclonal TRPM2 Antibody [DyLight 650]
NB500-242C 0.1 mL

Rabbit Polyclonal TRPM2 Antibody [DyLight 650]

Sign In for Pricing
View Details
TSPAN18 sgRNA CRISPR Lentivector (Human) (Target 1)
K2542802 1.0 µg DNA

TSPAN18 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human SIX6 Pre-designed siRNA Set B
SI014819B 1 Each

Human SIX6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
STAP2 (NM_001013841) Human Tagged ORF Clone
RC201518 10 µg

STAP2 (NM_001013841) Human Tagged ORF Clone

Sign In for Pricing
View Details