Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM25, Human (HEK293, His)

TMEM25 Protein, crucial in neurons, modulates the degradation of the NMDA receptor GRIN2B subunit, influencing the intricate regulation of neuronal excitability. Its interaction with GRIN2B highlights its role in dynamic processes central to neurotransmission and synaptic function. TMEM25 Protein, Human (HEK293, His) is the recombinant human-derived TMEM25 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM25 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem25-protein-human-hek293-his.html

Purity

98.0

Smiles

ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAP

Molecular Formula

84866 (Gene_ID) Q86YD3-2/AAH51841.1 (E27-P224) (Accession)

Molecular Weight

Approximately 32-60 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wisp3 (NM_001127376) Mouse Tagged Lenti ORF Clone
MR223941L3 10 µg

Wisp3 (NM_001127376) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal HSP27 Antibody [DyLight 550]
NBP1-75477R 0.1 mL

Rabbit Polyclonal HSP27 Antibody [DyLight 550]

Sign In for Pricing
View Details
RAB11A (NM_004663) Human Tagged ORF Clone
RC200352 10 µg

RAB11A (NM_004663) Human Tagged ORF Clone

Sign In for Pricing
View Details
SATB1 Rabbit mAb
MBS9467383-01 0.05 mL

SATB1 Rabbit mAb

Sign In for Pricing
View Details
SATB1 Rabbit mAb
MBS9467383-02 0.1 mL

SATB1 Rabbit mAb

Sign In for Pricing
View Details
SATB1 Rabbit mAb
MBS9467383-03 5x 0.1 mL

SATB1 Rabbit mAb

Sign In for Pricing
View Details