Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM25, Human (HEK293, His)

TMEM25 Protein, crucial in neurons, modulates the degradation of the NMDA receptor GRIN2B subunit, influencing the intricate regulation of neuronal excitability. Its interaction with GRIN2B highlights its role in dynamic processes central to neurotransmission and synaptic function. TMEM25 Protein, Human (HEK293, His) is the recombinant human-derived TMEM25 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM25 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem25-protein-human-hek293-his.html

Purity

98.0

Smiles

ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAP

Molecular Formula

84866 (Gene_ID) Q86YD3-2/AAH51841.1 (E27-P224) (Accession)

Molecular Weight

Approximately 32-60 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUX1 ORF Vector (Human) (pORF)
ORF017854 1.0 µg DNA

CUX1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FOXD4L2 (NM_001099279) Human Over-expression Lysate
LS100036519-20ug 20 µg

FOXD4L2 (NM_001099279) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Myelin and lymphocyte protein, Mal ELISA KIT
ELI-06312m 96 Tests

Mouse Myelin and lymphocyte protein, Mal ELISA KIT

Sign In for Pricing
View Details
Phospho-OCT4(S236) Antibody Blocking peptide
MBS9225240-01 0.5 mg

Phospho-OCT4(S236) Antibody Blocking peptide

Sign In for Pricing
View Details
Phospho-OCT4(S236) Antibody Blocking peptide
MBS9225240-02 5x 0.5 mg

Phospho-OCT4(S236) Antibody Blocking peptide

Sign In for Pricing
View Details
Recombinant Mouse Epithelial membrane protein 2 (Emp2)
MBS7014250-01 0.02 mg

Recombinant Mouse Epithelial membrane protein 2 (Emp2)

Sign In for Pricing
View Details