Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM25, Human (HEK293, His)

TMEM25 Protein, crucial in neurons, modulates the degradation of the NMDA receptor GRIN2B subunit, influencing the intricate regulation of neuronal excitability. Its interaction with GRIN2B highlights its role in dynamic processes central to neurotransmission and synaptic function. TMEM25 Protein, Human (HEK293, His) is the recombinant human-derived TMEM25 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM25 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem25-protein-human-hek293-his.html

Purity

98.0

Smiles

ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAP

Molecular Formula

84866 (Gene_ID) Q86YD3-2/AAH51841.1 (E27-P224) (Accession)

Molecular Weight

Approximately 32-60 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCG-beta (HCGb/54+ HCGb/459), CF660R conjugate, 0.1mg/mL
BNC611224-100 1x 100 µL

HCG-beta (HCGb/54+ HCGb/459), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF405S conjugate, 0.1mg/mL
BNC040764-100 1x 100 µL

CD79a (IGA/764), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (K72.7), CF568 conjugate, 0.1mg/mL
BNC680757-100 1x 100 µL

Cytokeratin 7 (K72.7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), CF594 conjugate, 0.1mg/mL
BNC941120-500 1x 500 µL

Ep-CAM / CD326 (EGP40/1120), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF568 conjugate, 0.1mg/mL
BNC681788-500 1x 500 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/261), CF740 conjugate, 0.1mg/mL
BNC740261-100 1x 100 µL

CD66 (CEA) (C66/261), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details