Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM25, Human (HEK293, His)

TMEM25 Protein, crucial in neurons, modulates the degradation of the NMDA receptor GRIN2B subunit, influencing the intricate regulation of neuronal excitability. Its interaction with GRIN2B highlights its role in dynamic processes central to neurotransmission and synaptic function. TMEM25 Protein, Human (HEK293, His) is the recombinant human-derived TMEM25 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMEM25 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmem25-protein-human-hek293-his.html

Purity

98.0

Smiles

ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAP

Molecular Formula

84866 (Gene_ID) Q86YD3-2/AAH51841.1 (E27-P224) (Accession)

Molecular Weight

Approximately 32-60 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shank3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6778706 1.0 µg DNA

Shank3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Vabametkib
MBS5812975 Inquire

Vabametkib

Sign In for Pricing
View Details
Mouse DediCator of cytokinesis protein 2, DOCK2 ELISA Kit
MBS9328886-01 48 Well

Mouse DediCator of cytokinesis protein 2, DOCK2 ELISA Kit

Sign In for Pricing
View Details
Mouse DediCator of cytokinesis protein 2, DOCK2 ELISA Kit
MBS9328886-02 96 Well

Mouse DediCator of cytokinesis protein 2, DOCK2 ELISA Kit

Sign In for Pricing
View Details
Mouse DediCator of cytokinesis protein 2, DOCK2 ELISA Kit
MBS9328886-03 5x 96 Well

Mouse DediCator of cytokinesis protein 2, DOCK2 ELISA Kit

Sign In for Pricing
View Details
Mouse DediCator of cytokinesis protein 2, DOCK2 ELISA Kit
MBS9328886-04 10x 96 Well

Mouse DediCator of cytokinesis protein 2, DOCK2 ELISA Kit

Sign In for Pricing
View Details