Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBL1, Human (HEK293, His)

NBL1 protein, identified as a potential tumor suppressor gene in neuroblastoma, plays a crucial role in inhibiting cells from progressing into the critical G1/S stage of the transformation process. Functioning as a homodimer, NBL1 underscores its involvement in regulatory mechanisms governing cellular transformation and emphasizes its potential contributions to maintaining normal cellular growth control. NBL1 Protein, Human (HEK293, His) is the recombinant human-derived NBL1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NBL1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nbl1-protein-human-hek293-his.html

Purity

95.00

Smiles

AAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED

Molecular Formula

100532736/4681 (Gene_ID) P41271 (A17-D181) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-100 1x 100 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-100 1x 100 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3), CF488A conjugate, 0.1mg/mL
BNC880049-500 1x 500 µL

CD31 / PECAM-1 (C31.3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details