Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR1, Canine (HEK293, His)

Activin A receptor, type I (ACVR1), also known as ALK-2, is a bone morphogenetic protein (BMP) type I receptor. ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation[1]. ACVR1 Protein, Canine (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

Product Specifications

Product Name Alternative

ACVR1 Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr1-protein-canine-hek293-his.html

Purity

96.00

Smiles

DEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPETQNFHLE

Molecular Formula

478757 (Gene_ID) A0A811ZNW1/XP_549615.2 (D23-E123) (Accession)

Molecular Weight

Approximately 17-21 kDa due to the glycosylation.

References & Citations

[1]José Antonio Valer, et al. ACVR1 Function in Health and Disease. Cells. 2019 Oct 31;8 (11) :1366.|[2]Jing Pang, et al. ACVR1-Fc suppresses BMP signaling and chondro-osseous differentiation in an in vitro model of Fibrodysplasia ossificans progressive. Bone. 2016 Nov;92:29-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog