Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMI1, Human (His)

BMI1 Protein, a component of the Polycomb group PRC1-like complex, maintains transcriptional repression in genes, including Hox genes, by monoubiquitinating histone H2A. It regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacts with various partners in the PRC1-like complex, such as RNF2, CBX2, CBX4, CBX8, PHC1, PHC2, PHC3, and UB2D3, forming complexes crucial for chromatin modification and gene expression control. BMI1 Protein, Human (E.coli, N-His) is the recombinant human-derived BMI1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

BMI1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmi1-protein-human-e-coli-n-his.html

Purity

90.00

Smiles

MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

Molecular Formula

648 (Gene_ID) P35226 (M1-G326) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MM-102 TFA 2mg
A21941-2 2 mg

MM-102 TFA 2mg

Sign In for Pricing
View Details
Phospho-IRS1 (Tyr632) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-8707R-BF488 100 µL

Phospho-IRS1 (Tyr632) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
APOC1 Protein Vector (Human) (pPB-His-MBP)
PV322870 500 ng

APOC1 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Sirt1 Recombinant Protein (Mouse)
RP171962 100 µg

Sirt1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal SET1B Antibody [Alexa Fluor 532]
NBP3-06532AF532 0.1 mL

Rabbit Polyclonal SET1B Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
ALS7 Protein Vector (Human) (pPM-C-His)
PV062004 500 ng

ALS7 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details