Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD18 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to CARD18

Product Specifications

Product Name Alternative

Anti ICEBERG antibody, anti UNQ5804 antibody, anti pseudo-ICE antibody

UniProt

P57730

Reactivity

Human

Immunogen

The immunogen for Anti-CARD18 antibody is: synthetic peptide directed towards the middle region of Human CAR18

Target

CARD18

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: DEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDP

Purification

Affinity purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

9 kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_067546.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPM8, CT (C940) (Transient Receptor Potential Cation Channel Subfamily M Member 8, Long Transient Receptor Potential Channel 6, LTrpC-6, LTrpC6, Transient Receptor Potential-p8, Trp-p8, LTRPC6, TRPP8) (MaxLight 490)
MBS6503855-01 0.1 mL

TRPM8, CT (C940) (Transient Receptor Potential Cation Channel Subfamily M Member 8, Long Transient Receptor Potential Channel 6, LTrpC-6, LTrpC6, Transient Receptor Potential-p8, Trp-p8, LTRPC6, TRPP8) (MaxLight 490)

Sign In for Pricing
View Details
TRPM8, CT (C940) (Transient Receptor Potential Cation Channel Subfamily M Member 8, Long Transient Receptor Potential Channel 6, LTrpC-6, LTrpC6, Transient Receptor Potential-p8, Trp-p8, LTRPC6, TRPP8) (MaxLight 490)
MBS6503855-02 5x 0.1 mL

TRPM8, CT (C940) (Transient Receptor Potential Cation Channel Subfamily M Member 8, Long Transient Receptor Potential Channel 6, LTrpC-6, LTrpC6, Transient Receptor Potential-p8, Trp-p8, LTRPC6, TRPP8) (MaxLight 490)

Sign In for Pricing
View Details
Human SMCR8 Knockout A549 cell line
GTR15402700 1 Vial

Human SMCR8 Knockout A549 cell line

Sign In for Pricing
View Details
Rabbit anti-human 52 kDa repressor of the inhibitor of the protein kinase polyclonal Antibody, FITC
MBS1489584-01 0.05 mg

Rabbit anti-human 52 kDa repressor of the inhibitor of the protein kinase polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human 52 kDa repressor of the inhibitor of the protein kinase polyclonal Antibody, FITC
MBS1489584-02 0.1 mg

Rabbit anti-human 52 kDa repressor of the inhibitor of the protein kinase polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human 52 kDa repressor of the inhibitor of the protein kinase polyclonal Antibody, FITC
MBS1489584-03 5x 0.1 mg

Rabbit anti-human 52 kDa repressor of the inhibitor of the protein kinase polyclonal Antibody, FITC

Sign In for Pricing
View Details