Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mucin-1/MUC1, Human (HEK293, mFc)

Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (HEK293, mFc) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Mucin-1/MUC1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mucin-1-muc1-protein-human-hek293-mfc.html

Purity

97.0

Smiles

SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG

Molecular Formula

4582 (Gene_ID) P15941-1 (S1098-G1158) (Accession)

Molecular Weight

Approximately 38-43 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-GRASP65 antibody
SL7802R-01 50 µL

Rabbit Anti-GRASP65 antibody

Sign In for Pricing
View Details
Rabbit Anti-GRASP65 antibody
SL7802R-02 100 µL

Rabbit Anti-GRASP65 antibody

Sign In for Pricing
View Details
Rat Glutamate Cysteine Ligase, Modifier Subunit (GCLM) CLIA Kit
abx492347-01 96 Tests

Rat Glutamate Cysteine Ligase, Modifier Subunit (GCLM) CLIA Kit

Sign In for Pricing
View Details
Rat Glutamate Cysteine Ligase, Modifier Subunit (GCLM) CLIA Kit
abx492347-02 5x 96 Tests

Rat Glutamate Cysteine Ligase, Modifier Subunit (GCLM) CLIA Kit

Sign In for Pricing
View Details
Rat Glutamate Cysteine Ligase, Modifier Subunit (GCLM) CLIA Kit
abx492347-03 10x 96 Tests

Rat Glutamate Cysteine Ligase, Modifier Subunit (GCLM) CLIA Kit

Sign In for Pricing
View Details
Human Protocadherin-10 Recombinant Protein C-6 His Tag Lyophilized 50UG
IHUPCDH10RC6HISLY50UG 50 µg

Human Protocadherin-10 Recombinant Protein C-6 His Tag Lyophilized 50UG

Sign In for Pricing
View Details