Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1A2 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to OR1A2

Product Specifications

Product Name Alternative

Anti MGC119930 antibody, anti MGC119931 antibody, anti OR17-6 antibody

UniProt

Q9Y585

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1A2

Target

OR1A2

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: YGTTMGMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQ

Field of Research

Cell Biology, Signal Transduction

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

34kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036484

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC554202 Protein Vector (Human) (pPM-C-His)
PV024080 500 ng

LOC554202 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
DBT Recombinant Protein (Human)
RP054180 100 µg

DBT Recombinant Protein (Human)

Sign In for Pricing
View Details
Human SPTAN1 Knockout A549 cell line
GTR15415073 1 Vial

Human SPTAN1 Knockout A549 cell line

Sign In for Pricing
View Details
Erk1,2, phosphorylated (Thr185, Tyr187) (Extracellular Signal-regulated Kinase 1, ERK1, ERK-1, ERK, Extracellular Signal-regulated Kinase 2, ERK2, ERK-2, ERT1, ERT2, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p42, MAP Kinase Isoform p44, Microtubule-associated Protein 2 Kinase, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, MAPK1, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, MAPK2, Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, MAPK3, p41mapk, p42-MAPK, P42MAPK, P44ERK1, p44-ERK1, P44MAPK, p44-MAPK, PRKM1, PRKM2, PRKM3)
E3452-52 10 Blots

Erk1,2, phosphorylated (Thr185, Tyr187) (Extracellular Signal-regulated Kinase 1, ERK1, ERK-1, ERK, Extracellular Signal-regulated Kinase 2, ERK2, ERK-2, ERT1, ERT2, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p42, MAP Kinase Isoform p44, Microtubule-associated Protein 2 Kinase, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, MAPK1, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, MAPK2, Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, MAPK3, p41mapk, p42-MAPK, P42MAPK, P44ERK1, p44-ERK1, P44MAPK, p44-MAPK, PRKM1, PRKM2, PRKM3)

Sign In for Pricing
View Details
CXCR3 Human Pre-designed siRNA Set A
HY-RS03403 1 Set

CXCR3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
OR2J4P Recombinant Protein (Human)
RP079944 100 µg

OR2J4P Recombinant Protein (Human)

Sign In for Pricing
View Details