Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CutA, Human (His)

CUTA protein is a trimeric membrane anchor protein of AChE and a homolog of the bacterial divalent cation chelator CutA1 protein. CUTA protein also interacts with BACE1 and inhibits APP beta processing and Aβ production. CutA Protein, Human (His) is the recombinant human-derived CutA protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CutA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cuta-protein-human-his.html

Purity

95.71

Smiles

MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP

Molecular Formula

51596 (Gene_ID) O60888-3 (M1-P156) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Connexin 30, GJB6, Gap Junction Protein, beta 6, (30kDa)
MBS630396-01 0.1 mg

Connexin 30, GJB6, Gap Junction Protein, beta 6, (30kDa)

Ask
View Details
Connexin 30, GJB6, Gap Junction Protein, beta 6, (30kDa)
MBS630396-02 5x 0.1 mg

Connexin 30, GJB6, Gap Junction Protein, beta 6, (30kDa)

Ask
View Details
MAP Kinase 4 (Mitogen-activated Protein Kinase 4, MAPK 4, MAPK4, Extracellular Signal-regulated Kinase 4, ERK4, ERK-4, MAP Kinase Isoform p63, p63-MAPK, p63MAPK, PRKM4) (APC)
129354-APC 100 µL

MAP Kinase 4 (Mitogen-activated Protein Kinase 4, MAPK 4, MAPK4, Extracellular Signal-regulated Kinase 4, ERK4, ERK-4, MAP Kinase Isoform p63, p63-MAPK, p63MAPK, PRKM4) (APC)

Ask
View Details
Rabbit Monoclonal CD31/PECAM-1 Antibody (C31/8592R) [DyLight 755]
NBP3-24094IR 0.1 mL

Rabbit Monoclonal CD31/PECAM-1 Antibody (C31/8592R) [DyLight 755]

Ask
View Details
Rabbit Anti-DC1I1/DYNC1I1 Polyclonal Antibody
PAV1110 100 μL

Rabbit Anti-DC1I1/DYNC1I1 Polyclonal Antibody

Ask
View Details