Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CutA, Human (His)

CUTA protein is a trimeric membrane anchor protein of AChE and a homolog of the bacterial divalent cation chelator CutA1 protein. CUTA protein also interacts with BACE1 and inhibits APP beta processing and Aβ production. CutA Protein, Human (His) is the recombinant human-derived CutA protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CutA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cuta-protein-human-his.html

Purity

95.71

Smiles

MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP

Molecular Formula

51596 (Gene_ID) O60888-3 (M1-P156) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1B2P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
18974061 1.0 µg DNA

EEF1B2P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
NVP-BHG712
MBS132213-01 100 mg

NVP-BHG712

Sign In for Pricing
View Details
NVP-BHG712
MBS132213-02 500 mg

NVP-BHG712

Sign In for Pricing
View Details
IZUMO1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
25219156 3x 1.0 µg DNA

IZUMO1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Recombinant Rat Monoglyceride lipase Protein, His, Yeast-1mg
QP9272-ye-1mg 1mg

Recombinant Rat Monoglyceride lipase Protein, His, Yeast-1mg

Sign In for Pricing
View Details
Clec2g Protein Vector (Mouse) (pPM-C-His)
PV166125 500 ng

Clec2g Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details