Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CutA, Human (His)

CUTA protein is a trimeric membrane anchor protein of AChE and a homolog of the bacterial divalent cation chelator CutA1 protein. CUTA protein also interacts with BACE1 and inhibits APP beta processing and Aβ production. CutA Protein, Human (His) is the recombinant human-derived CutA protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CutA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cuta-protein-human-his.html

Purity

95.71

Smiles

MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP

Molecular Formula

51596 (Gene_ID) O60888-3 (M1-P156) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentafluorophenyl 3-bromo-benzenesulfonate
sc-338378A 5 g

Pentafluorophenyl 3-bromo-benzenesulfonate

Sign In for Pricing
View Details
Rabbit Polyclonal STARD10 Antibody [DyLight 594]
NBP2-98108DL594 0.1 mL

Rabbit Polyclonal STARD10 Antibody [DyLight 594]

Sign In for Pricing
View Details
HPSE Rabbit Polyclonal Antibody
TA421166 100 µg

HPSE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Anti-Chicken CD44
31-3117-0.5 0.5 mg

Mouse Anti-Chicken CD44

Sign In for Pricing
View Details
Rat Serine/Threonine Protein Kinase ICK (ICK) ELISA Kit
abx391500 96 Tests

Rat Serine/Threonine Protein Kinase ICK (ICK) ELISA Kit

Sign In for Pricing
View Details
RXRB ELISA Kit (Human)
OKEH02105-96W 96 Well

RXRB ELISA Kit (Human)

Sign In for Pricing
View Details