CutA, Human (His)
CUTA protein is a trimeric membrane anchor protein of AChE and a homolog of the bacterial divalent cation chelator CutA1 protein. CUTA protein also interacts with BACE1 and inhibits APP beta processing and Aβ production. CutA Protein, Human (His) is the recombinant human-derived CutA protein, expressed by E. coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CutA Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cuta-protein-human-his.html
Purity
95.71
Smiles
MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP
Molecular Formula
51596 (Gene_ID) O60888-3 (M1-P156) (Accession)
Molecular Weight
Approximately 17.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
11435091 4x 500 ng
ADORA2A-set siRNA/shRNA/RNAi Lentivector (Human)
Sign In for Pricing
View Details MBS1053551-01 0.02 mg (E-Coli)
Recombinant Vaccinia virus Protein A32 (A32L)
Sign In for Pricing
View Details MBS1053551-02 0.02 mg (Yeast)
Recombinant Vaccinia virus Protein A32 (A32L)
Sign In for Pricing
View Details MBS1053551-03 0.1 mg (E-Coli)
Recombinant Vaccinia virus Protein A32 (A32L)
Sign In for Pricing
View Details