Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR1, Human (Biotinylated, HEK293, His-Avi)

The FOLR1 protein is an important mediator of folate uptake, binding to folate and promoting the delivery of 5-methyltetrahydrofolate into cells. Studies show high affinity at neutral pH. FOLR1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived FOLR1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

FOLR1 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folate-receptor-alpha-protein-human-hek-293-his-avi.html

Smiles

RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS

Molecular Formula

2348 (Gene_ID) P15328 (R25-S234) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog