Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCSH, Human (His)

GCSH protein, a vital component of the glycine cleavage system, efficiently shuttles the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST), contributing to glycine degradation. GCSH Protein, Human (His) is the recombinant human-derived GCSH protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GCSH Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gcsh-protein-human-his.html

Purity

98.0

Smiles

SVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE

Molecular Formula

2653 (Gene_ID) P23434 (S49-E173) (Accession)

Molecular Weight

Approximately 17 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ang4 (NM_177544) Mouse Tagged ORF Clone Lentiviral Particle
MR200945L3V 200 µL

Ang4 (NM_177544) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Mouse Monoclonal Patched 1/PTCH Antibody (OTI5C7) [Alexa Fluor 532]
NBP2-73253AF532 0.1 mL

Mouse Monoclonal Patched 1/PTCH Antibody (OTI5C7) [Alexa Fluor 532]

Ask
View Details
Pregnancy Associated Plasma Protein A (PAPP-A, Pappalysin 1, PAPA, PAPPA, PAPP-A, PAPPA1, Aspecific BCL2 ARE-binding Protein 2, ASBABP2, Differentially Placenta 1 Expressed Protein, DIPLA1, EC 3.4.24.79, IGF-dependent IGFBP-4 Protease, IGFBP-4ase, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, Pappalysin 1 Precursor) (FITC)
P6000-81-FITC 100 µL

Pregnancy Associated Plasma Protein A (PAPP-A, Pappalysin 1, PAPA, PAPPA, PAPP-A, PAPPA1, Aspecific BCL2 ARE-binding Protein 2, ASBABP2, Differentially Placenta 1 Expressed Protein, DIPLA1, EC 3.4.24.79, IGF-dependent IGFBP-4 Protease, IGFBP-4ase, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, Pappalysin 1 Precursor) (FITC)

Ask
View Details
Human Atrial natriuretic peptide,h-ANP ELISA KIT
JOT-EK2004Hu 96 wells

Human Atrial natriuretic peptide,h-ANP ELISA KIT

Ask
View Details
Pig Transcription factor SOX-9, SOX9 ELISA Kit
MBS9340671-01 48 Well

Pig Transcription factor SOX-9, SOX9 ELISA Kit

Ask
View Details
Pig Transcription factor SOX-9, SOX9 ELISA Kit
MBS9340671-02 96 Well

Pig Transcription factor SOX-9, SOX9 ELISA Kit

Ask
View Details