Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD9, Human (HEK293, His)

CD9 protein is an integral membrane protein that plays a critical regulatory role in processes such as sperm-egg fusion, platelet activation, and cell adhesion. CD9 is critical for sperm-egg fusion, coordinating multi-protein complexes on the oocyte surface. CD9 Protein, Human (HEK293, His) is the recombinant human-derived CD9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD9 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd9-protein-human-hek-293-his.html

Purity

95.0

Smiles

SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Molecular Formula

928 (Gene_ID) P21926 (S112-I195) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsc22d4 siRNA Oligos set (Mouse)
48549174 3x 5 nmol

Tsc22d4 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
FAM82A1 (RMDN2) (NM_001170791) Human Untagged Clone
SC328663 10 µg

FAM82A1 (RMDN2) (NM_001170791) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Fumarate reductase subunit D (frdD)
MBS7015121-01 0.02 mg

Recombinant Fumarate reductase subunit D (frdD)

Sign In for Pricing
View Details
Recombinant Fumarate reductase subunit D (frdD)
MBS7015121-02 0.1 mg

Recombinant Fumarate reductase subunit D (frdD)

Sign In for Pricing
View Details
Recombinant Fumarate reductase subunit D (frdD)
MBS7015121-03 5x 0.1 mg

Recombinant Fumarate reductase subunit D (frdD)

Sign In for Pricing
View Details
Human TRAPPC13 Protein Lysate 20ug
IHUTRAPPC13PLLY20UG 20 µg

Human TRAPPC13 Protein Lysate 20ug

Sign In for Pricing
View Details