Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-3/LGALS3, Mouse

Galectin-3 (LGALS3) is involved in multiple activities, including IgE binding and signaling receptor binding. It negatively regulates T-cell receptor signaling and modulates immune responses by modulating endocytosis and lymphocyte activation. Galectin-3/LGALS3 Protein, Mouse is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Galectin-3/LGALS3 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-3-lgals3-protein-mouse.html

Purity

95.0

Smiles

ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAM

Molecular Formula

16854 (Gene_ID) NP_034835.1 (A2-I264) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Conductin CRISPR Activation Plasmid (m)
sc-419278-ACT 20 µg

Conductin CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Slc10a7 (NM_001010948) Rat Tagged ORF Clone Lentiviral Particle
RR202415L3V 200 µL

Slc10a7 (NM_001010948) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
OTTMUSG00000016609 3'UTR GFP Stable Cell Line
TU165776 1.0 mL

OTTMUSG00000016609 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
2- (2-phenylethanehydrazonoyl) pyridine
sc-334766A 1 g

2- (2-phenylethanehydrazonoyl) pyridine

Sign In for Pricing
View Details
CYB561 Peptide - middle region
MBS3231044-01 0.1 mg

CYB561 Peptide - middle region

Sign In for Pricing
View Details
CYB561 Peptide - middle region
MBS3231044-02 5x 0.1 mg

CYB561 Peptide - middle region

Sign In for Pricing
View Details