Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-3/LGALS3, Mouse

Galectin-3 (LGALS3) is involved in multiple activities, including IgE binding and signaling receptor binding. It negatively regulates T-cell receptor signaling and modulates immune responses by modulating endocytosis and lymphocyte activation. Galectin-3/LGALS3 Protein, Mouse is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Galectin-3/LGALS3 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-3-lgals3-protein-mouse.html

Purity

95.0

Smiles

ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAM

Molecular Formula

16854 (Gene_ID) NP_034835.1 (A2-I264) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cytomegalovirus Glycoprotein B, Late Neutralizing Antigen (CMVgB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (HRP)
MBS6250798-01 0.1 mL

Cytomegalovirus Glycoprotein B, Late Neutralizing Antigen (CMVgB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (HRP)

Ask
View Details
Cytomegalovirus Glycoprotein B, Late Neutralizing Antigen (CMVgB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (HRP)
MBS6250798-02 5x 0.1 mL

Cytomegalovirus Glycoprotein B, Late Neutralizing Antigen (CMVgB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (HRP)

Ask
View Details
TSPAN6, CT (TSPAN6, TM4SF6, Tetraspanin-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6) (FITC)
MBS6359620-01 0.2 mL

TSPAN6, CT (TSPAN6, TM4SF6, Tetraspanin-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6) (FITC)

Ask
View Details
TSPAN6, CT (TSPAN6, TM4SF6, Tetraspanin-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6) (FITC)
MBS6359620-02 5x 0.2 mL

TSPAN6, CT (TSPAN6, TM4SF6, Tetraspanin-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6) (FITC)

Ask
View Details
CD162 Antibody / PSGL-1
V4316SAF-100UG 100 µg

CD162 Antibody / PSGL-1

Ask
View Details
MIR6870 Human qPCR Template Standard (MI0022717)
HK301473 200 Reactions

MIR6870 Human qPCR Template Standard (MI0022717)

Ask
View Details