Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM266 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to C15orf27

Product Specifications

Product Name Alternative

Anti FLJ30304 antibody, anti FLJ38190 antibody

UniProt

Q2M3C6

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C15orf27

Target

TMEM266

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: PAGSAQTSPELEHRVSLFNQKNQEGFTVFQIRPVIHFQPTVPMLEDKFRS

Field of Research

Cell Biology

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

58kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689548

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXG1, ID (FOXG1, FKH2, FKHL1, FKHL2, FKHL3, FKHL4, FOXG1A, FOXG1B, FOXG1C, Forkhead box protein G1, Brain factor 1, Brain factor 2, Forkhead box protein G1A, Forkhead box protein G1B, Forkhead box protein G1C, Forkhead-related protein FKHL1, Forkhead-rel
MBS6010044-01 0.2 mL

FOXG1, ID (FOXG1, FKH2, FKHL1, FKHL2, FKHL3, FKHL4, FOXG1A, FOXG1B, FOXG1C, Forkhead box protein G1, Brain factor 1, Brain factor 2, Forkhead box protein G1A, Forkhead box protein G1B, Forkhead box protein G1C, Forkhead-related protein FKHL1, Forkhead-rel

Sign In for Pricing
View Details
FOXG1, ID (FOXG1, FKH2, FKHL1, FKHL2, FKHL3, FKHL4, FOXG1A, FOXG1B, FOXG1C, Forkhead box protein G1, Brain factor 1, Brain factor 2, Forkhead box protein G1A, Forkhead box protein G1B, Forkhead box protein G1C, Forkhead-related protein FKHL1, Forkhead-rel
MBS6010044-02 5x 0.2 mL

FOXG1, ID (FOXG1, FKH2, FKHL1, FKHL2, FKHL3, FKHL4, FOXG1A, FOXG1B, FOXG1C, Forkhead box protein G1, Brain factor 1, Brain factor 2, Forkhead box protein G1A, Forkhead box protein G1B, Forkhead box protein G1C, Forkhead-related protein FKHL1, Forkhead-rel

Sign In for Pricing
View Details
GLUL Knockout 786-O Polyclonal Cells
ARG5241 1 Million

GLUL Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Rabbit Polyclonal SNX1 Antibody
NBP2-56957 100 µL

Rabbit Polyclonal SNX1 Antibody

Sign In for Pricing
View Details
S100A14 cDNA Clone
MBS1271484-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

S100A14 cDNA Clone

Sign In for Pricing
View Details
S100A14 cDNA Clone
MBS1271484-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

S100A14 cDNA Clone

Sign In for Pricing
View Details