CD14, Human (HEK293, His)
CD14 Protein, Human (HEK293, His) is a recombinant human CD14 expressed in HEK 293 cells with a His tag at the N-terminus. CD14 Protein is an efficient target for recombinant immunoglobulin vaccine constructs that deliver T cell epitopes[1][2].
Product Specifications
Product Name Alternative
CD14 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd14-protein-human-hek293-his.html
Purity
98.0
Smiles
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC
Molecular Formula
929 (Gene_ID) P08571 (T20-C352) (Accession)
Molecular Weight
Approximately 54 kDa
References & Citations
[1]Wright SD, et, al. CD14, a receptor for complexes of lipopolysaccharide (LPS) and LPS binding protein. Science. 1990 Sep 21;249 (4975) :1431-3.|[2]Tunheim G, et, al. Human CD14 is an efficient target for recombinant immunoglobulin vaccine constructs that deliver T cell epitopes. J Leukoc Biol. 2005 Mar;77 (3) :303-10.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2605518-01 48 Well
Canine Rhesus major histocompatibility complex (MHC/RhLA) ELISA Kit
Sign In for Pricing
View Details MBS2605518-02 96 Well
Canine Rhesus major histocompatibility complex (MHC/RhLA) ELISA Kit
Sign In for Pricing
View Details MBS2605518-03 5x 96 Well
Canine Rhesus major histocompatibility complex (MHC/RhLA) ELISA Kit
Sign In for Pricing
View Details MBS2605518-04 10x 96 Well
Canine Rhesus major histocompatibility complex (MHC/RhLA) ELISA Kit
Sign In for Pricing
View Details